BCH403 FINAL EXAM QUESTIONS
WITH REVISED ANSWERS –
UPDATED!!
Stop codons are recognized by , which results in the termination of
translation. - Answer-Release factors
Argonaute: - Answer-Selects which strand of miRNA will be used to target mRNA
When run on an agarose gel, DNA will migrate through the gel: - Answer-Naturally
because DNA is already overwhelmingly negative
A technique commonly used to separate proteins based solely on length is called: -
Answer-SDS-Polyacrylamide gel electrophoresis (SDS-PAGE)
Alternative splicing: - Answer-requires the spliceosomes and additional components that
block splicing sites
When found in the Wobble position (5' of anticodon), guanine can form Wobble
interactions with: - Answer-U
The addition of the poly A tail: - Answer-Is coupled to transcription termination
Based on the codon table and the mRNA sequence below, which one of the following
point mutations represents a nonsense mutation? (Mutation is highlighted in orange).
Assume reading frame 1. - Answer-AUG AAU GAU CCG UAA GAU GAG
DNA directly transferred from one bacterium to another bacterium is called: - Answer-
Conjugation
Nuclear proteins: - Answer-Are translated by free ribosomes and transported into the
nucleus via the nuclear pore
Artificial restriction enzymes: - Answer-Uses DNA-binding proteins to guide an
endonuclease to the target DNA site
Which one of the following represents blunt cut DNA? (Note: ▼ represents site of cut
DNA) - Answer-CAT ▼ ATG
In eukaryotes, the aminoacyl-tRNA is loaded into the A-site of the ribosome by: -
Answer-eEF1α (alpha)
In prokaryotes, folded proteins are transported out of the cytoplasm via: - Answer-Twin
Arginine Transport (TAT) pathway
, The insertion of a gene into a genome is called: - Answer-Knock-in
Which of the following is NOT a potential function of specific transcription factors? -
Answer-Melt promoter DNA
The following peptide is dissolved in a solution of pH 7. M-D-L-P-S-K. What is the
peptide's net charge and can this peptide be purified by ion exchange chromatography?
- Answer-0, and it cannot because it is at the isoelectric point.
The process by which hydrophobic molecules are driven together, therefore maximizing
the entropy of water, is referred to as the hydrophobic effect - Answer-True
Which of the following pairs of amino acids are polar, but uncharged at neutral pH: -
Answer-N, Q
Which of the following is NOT TRUE regarding a biochemical reaction? - Answer-A
largely negative delta G means that eventually, the reactants will run out completely.
Which of the following is NOT part of the peptide bond plane? - Answer-R-group of the
second residue
Secondary structures are stabilized by which of the following? - Answer-Hydrogen-
bonding between a carbonyl oxygen and an amide hydrogen
In Myoglobin, the bound oxygen occupies the sixth ligand for iron, meaning that no
more than one molecule of oxygen can bind per molecule of protein - Answer-True
Interior packing of hydrophobic residues contributes favorably to both delta S and delta
H because of the hydrophobic effect and the many hydrogen-bonding interactions
between nonpolar side chains - Answer-False
The following amino acid sequence belongs to a fibrous protein.
GAAGPPGPAGPAGERGEQGAPGPSGFQGLPGPP. Which of the following is the best
match? - Answer-Tropocollagen
The following is the secondary structure of a polypeptide. The cylinders represent
amphipathic alpha helices. Which of the following primary sequences would most
closely match the structure? - Answer-
GMADRLLNEPRISSAIVASAAQWVSTIVKFAMKISAVIPR
WITH REVISED ANSWERS –
UPDATED!!
Stop codons are recognized by , which results in the termination of
translation. - Answer-Release factors
Argonaute: - Answer-Selects which strand of miRNA will be used to target mRNA
When run on an agarose gel, DNA will migrate through the gel: - Answer-Naturally
because DNA is already overwhelmingly negative
A technique commonly used to separate proteins based solely on length is called: -
Answer-SDS-Polyacrylamide gel electrophoresis (SDS-PAGE)
Alternative splicing: - Answer-requires the spliceosomes and additional components that
block splicing sites
When found in the Wobble position (5' of anticodon), guanine can form Wobble
interactions with: - Answer-U
The addition of the poly A tail: - Answer-Is coupled to transcription termination
Based on the codon table and the mRNA sequence below, which one of the following
point mutations represents a nonsense mutation? (Mutation is highlighted in orange).
Assume reading frame 1. - Answer-AUG AAU GAU CCG UAA GAU GAG
DNA directly transferred from one bacterium to another bacterium is called: - Answer-
Conjugation
Nuclear proteins: - Answer-Are translated by free ribosomes and transported into the
nucleus via the nuclear pore
Artificial restriction enzymes: - Answer-Uses DNA-binding proteins to guide an
endonuclease to the target DNA site
Which one of the following represents blunt cut DNA? (Note: ▼ represents site of cut
DNA) - Answer-CAT ▼ ATG
In eukaryotes, the aminoacyl-tRNA is loaded into the A-site of the ribosome by: -
Answer-eEF1α (alpha)
In prokaryotes, folded proteins are transported out of the cytoplasm via: - Answer-Twin
Arginine Transport (TAT) pathway
, The insertion of a gene into a genome is called: - Answer-Knock-in
Which of the following is NOT a potential function of specific transcription factors? -
Answer-Melt promoter DNA
The following peptide is dissolved in a solution of pH 7. M-D-L-P-S-K. What is the
peptide's net charge and can this peptide be purified by ion exchange chromatography?
- Answer-0, and it cannot because it is at the isoelectric point.
The process by which hydrophobic molecules are driven together, therefore maximizing
the entropy of water, is referred to as the hydrophobic effect - Answer-True
Which of the following pairs of amino acids are polar, but uncharged at neutral pH: -
Answer-N, Q
Which of the following is NOT TRUE regarding a biochemical reaction? - Answer-A
largely negative delta G means that eventually, the reactants will run out completely.
Which of the following is NOT part of the peptide bond plane? - Answer-R-group of the
second residue
Secondary structures are stabilized by which of the following? - Answer-Hydrogen-
bonding between a carbonyl oxygen and an amide hydrogen
In Myoglobin, the bound oxygen occupies the sixth ligand for iron, meaning that no
more than one molecule of oxygen can bind per molecule of protein - Answer-True
Interior packing of hydrophobic residues contributes favorably to both delta S and delta
H because of the hydrophobic effect and the many hydrogen-bonding interactions
between nonpolar side chains - Answer-False
The following amino acid sequence belongs to a fibrous protein.
GAAGPPGPAGPAGERGEQGAPGPSGFQGLPGPP. Which of the following is the best
match? - Answer-Tropocollagen
The following is the secondary structure of a polypeptide. The cylinders represent
amphipathic alpha helices. Which of the following primary sequences would most
closely match the structure? - Answer-
GMADRLLNEPRISSAIVASAAQWVSTIVKFAMKISAVIPR
